PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G175100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 314aa    MW: 34884.6 Da    PI: 9.7823
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G175100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.11.5e-54109204297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqd+flPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkc rekrktingddllwa++tlGfe+yv plk yl+kyre
  Prupe.6G175100.1.p 109 KEQDKFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCLREKRKTINGDDLLWAMTTLGFENYVGPLKGYLNKYRE 199
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +egek
  Prupe.6G175100.1.p 200 TEGEK 204
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-54106237IPR009072Histone-fold
SuperFamilySSF471131.38E-40111234IPR009072Histone-fold
PfamPF008083.4E-26114178IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.1E-18142160No hitNo description
PROSITE patternPS006850145161IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.1E-18161179No hitNo description
PRINTSPR006155.1E-18180198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSARVSEPLN LHPTTNSSGT AQPEAKGEKK KKKVFQRTAQ ARAQDSTTNT QHKKEKGRKR  60
KTSTHFPSLA FPFSISHNHS ELNSMSGRRN QTSPVGSPLS GNVSDGSSKE QDKFLPIANV  120
SRIMKKSLPA NAKISKEAKE TVQECVSEFI SFITGEASDK CLREKRKTIN GDDLLWAMTT  180
LGFENYVGPL KGYLNKYRET EGEKNSMTRQ EEDPSQQQQQ HLNTSNTNMQ HSSNNEQMNT  240
VLNANNISMS TSKVDLFNGG FYFLEGQQQQ QEVTQNYNLV SAGAYNLSRI NESGDVNGNR  300
DLATHHLHNG IGW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-40109199292Transcription factor HapC (Eurofung)
4g92_B3e-40109199292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205885.11e-154hypothetical protein PRUPE_ppa011298mg
TrEMBLM5W0471e-154M5W047_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s08510.16e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-61nuclear factor Y, subunit B3